Structure of PDB 2bng Chain B |
>2bngB (length=133) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] |
PETTEAIRAVEAFLNALQNEDFDTVDAALGDDLVYENVGFSRIRGGRRTA TLLRRMQGRVGFEVKIHRIGADGAAVLTERTDALIIGPLRVQFWVCGVFE VDDGRITLWRDYFDVYDMFKGLLRGLVALVVPS |
|
PDB | 2bng Structure of an Atypical Epoxide Hydrolase from Mycobacterium Tuberculosis Gives Insights Into its Function. |
Chain | B |
Resolution | 2.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
E13 D114 |
E2 D103 |
|
|
|
|