Structure of PDB 2bh2 Chain B

Receptor sequence

>2bh2B (length=416) Species: 562 (Escherichia coli) [Search protein sequence]

IITVSVNDLDSFGQGVARHNGKTLFIPGLLPQENAEVTVTEDKKQYARAK
VVRRLSDSPERETPRCPHFGVCGGCQQQHASVDLQQRSKSAALARLMKHD
VSEVIADVPWGYRRRARLSLNYLPKTQQLQMGFRKAGSSDIVDVKQCPIL
APQLEALLPKVRACLGSLQAMRHLGHVELVQATSGTLMILRHTAPLSSAD
REKLERFSHSEGLDLYLAPDSEILETVSGEMPWYDSNGLRLTFSPRDFIQ
VNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLATQAASVVGVE
GVPALVEKGQQNARLNGLQNVTFYHENLEEDVTKQPWAKNGFDKVLLDPA
RAGAAGVMQQIIKLEPIRIVYVSCNPATLARDSEALLKAGYTIARLAMLD
MFPHTGHLESMVLFSR

3D structure

PDB

2bh2 A Unique RNA Fold in the Ruma-RNA-Cofactor Ternary Complex Contributes to Substrate Selectivity and Enzymatic Function

Chain

Resolution

2.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.1.1.190: 23S rRNA (uracil(1939)-C(5))-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	B	D23 D25 F27 R33 G36 K37 T38 F40 K59 Q60 G88 G89 R110 R128 R130 A131 R132 L135 N136 F148 R149 G152 S153 S154 G190 H191 R206 T208 F263 Q265 G316 N342 D363 P364 R366 C389 A392 R396 F417 H422 E424	D8 D10 F12 R18 G21 K22 T23 F25 K44 Q45 G73 G74 R95 R113 R115 A116 R117 L120 N121 F133 R134 G137 S138 S139 G175 H176 R191 T193 F248 Q250 G301 N327 D348 P349 R351 C374 A377 R381 F402 H407 E409
BS02	SAH	B	F263 Q265 F294 C295 N299 E315 G316 N342 L343 D363	F248 Q250 F279 C280 N284 E300 G301 N327 L328 D348
BS03	SF4	B	C81 C87 C90 Q93 F148 C162 P163 I164	C66 C72 C75 Q78 F133 C147 P148 I149

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005506	iron ion binding
GO:0008168	methyltransferase activity
GO:0008173	RNA methyltransferase activity
GO:0008757	S-adenosylmethionine-dependent methyltransferase activity
GO:0046872	metal ion binding
GO:0051539	4 iron, 4 sulfur cluster binding
GO:0070041	rRNA (uridine-C5-)-methyltransferase activity

	Biological Process
GO:0006364	rRNA processing
GO:0006396	RNA processing
GO:0009451	RNA modification
GO:0031167	rRNA methylation
GO:0032259	methylation
GO:0070475	rRNA base methylation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2bh2, PDBe:2bh2, PDBj:2bh2
PDBsum	2bh2
PubMed	15766524
UniProt	P55135\|RLMD_ECOLI 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Gene Name=rlmD)

[Back to BioLiP]