Structure of PDB 2b77 Chain B |
>2b77B (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] |
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGRYTIAALL SPYSYSTTAVVT |
|
PDB | 2b77 Diflunisal analogues stabilize the native state of transthyretin. Potent inhibition of amyloidogenesis. |
Chain | B |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3CA |
B |
K15 L110 |
K6 L99 |
|
|
|
|