Structure of PDB 2b76 Chain B

Receptor sequence

>2b76B (length=243) Species: 562 (Escherichia coli)

AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPD
LSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIER
DLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCIN
CGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNG
VWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR

3D structure

• PDB: 2b76 Fumarate Reductase and Succinate Oxidase Activity of Escherichia coli Complex II Homologs Are Perturbed Differently by Mutation of the Flavin Binding Domain
• Chain: B
• Resolution: 3.3 Å

Enzymatic activity

• Enzyme Commision number: 1.3.5.1: succinate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	B	C57 R58 A60 C62 G63 C65 C77	C57 R58 A60 C62 G63 C65 C77
BS02	F3S	B	C158 C204 F206 V207 G208 C210	C158 C204 F206 V207 G208 C210
BS03	SF4	B	C148 I149 C151 G152 C154 C214 P215	C148 I149 C151 G152 C154 C214 P215

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008177 succinate dehydrogenase (quinone) activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0006113 fermentation
• GO:0009061 anaerobic respiration
• GO:0019645 anaerobic electron transport chain
• GO:0044780 bacterial-type flagellum assembly

Cellular Component

• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0045283 fumarate reductase complex

External links

• PDB: RCSB:2b76, PDBe:2b76, PDBj:2b76
• PDBsum: 2b76
• PubMed: 16484232
• UniProt: P0AC47|FRDB_ECOLI Fumarate reductase iron-sulfur subunit (Gene Name=frdB)