Structure of PDB 2azx Chain B

Receptor sequence

>2azxB (length=388) Species: 9606 (Homo sapiens) [Search protein sequence]

EDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHF
LRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTK
WLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYGDAVENAKDIIACGFDINK
TFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFP
AIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPK
PALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGR
DTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELK
KALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFD

3D structure

PDB

2azx Two conformations of a crystalline human tRNA synthetase-tRNA complex: implications for protein synthesis.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

6.1.1.2: tryptophan--tRNA ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	B	N373 K374 F377 S378 G380 R381 D382 T383 I384 L426 T427 G428 K431	N292 K293 F296 S297 G299 R300 D301 T302 I303 L345 T346 G347 K350
BS02	MG	B	D354 S357 S358	D273 S276 S277
BS03	TRP	B	Y159 T160 G161 R162 G163 Q194 E199 Q284 Q313 F317	Y78 T79 G80 R81 G82 Q113 E118 Q203 Q232 F236

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0004812	aminoacyl-tRNA ligase activity
GO:0004830	tryptophan-tRNA ligase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0016874	ligase activity
GO:0019210	kinase inhibitor activity
GO:0019901	protein kinase binding
GO:0019904	protein domain specific binding
GO:0042803	protein homodimerization activity

	Biological Process
GO:0001525	angiogenesis
GO:0006412	translation
GO:0006418	tRNA aminoacylation for protein translation
GO:0006436	tryptophanyl-tRNA aminoacylation
GO:0006469	negative regulation of protein kinase activity
GO:0008285	negative regulation of cell population proliferation
GO:0010628	positive regulation of gene expression
GO:0031334	positive regulation of protein-containing complex assembly
GO:0045765	regulation of angiogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0032991	protein-containing complex
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2azx, PDBe:2azx, PDBj:2azx
PDBsum	2azx
PubMed	16724112
UniProt	P23381\|SYWC_HUMAN Tryptophan--tRNA ligase, cytoplasmic (Gene Name=WARS1)

[Back to BioLiP]