Structure of PDB 2aza Chain B |
>2azaB (length=129) Species: 85698 (Achromobacter xylosoxidans) [Search protein sequence] |
AQCEATIESNDAMQYDLKEMVVDKSCKQFTVHLKHVGKMAKSAMGHNWVL TKEADKEGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVS KLTPGEAYAYFCSFPGHWAMMKGTLKLSN |
|
PDB | 2aza Structure of azurin from Alcaligenes denitrificans refinement at 1.8 A resolution and comparison of the two crystallographically independent molecules. |
Chain | B |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
H46 C112 H117 |
H46 C112 H117 |
|
|
|
|