Structure of PDB 2atl Chain B

Receptor sequence

>2atlB (length=341) Species: 2287 (Saccharolobus solfataricus)

GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 2atl Stepwise Translocation of Dpo4 Polymerase during Error-Free Bypass of an oxoG Lesion
• Chain: B
• Resolution: 2.8 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	S1103 E1106 P1184 G1185 G1187 I1189 T1190 S1297 R1298 G1299 T1301	S103 E106 P184 G185 G187 I189 T190 S297 R298 G299 T301
BS02	dna	B	V1032 R1036 F1037 S1040 G1041 A1042 E1219 A1220 R1242 K1243 S1244 R1247 I1248 T1250 R1331 R1332 R1336	V32 R36 F37 S40 G41 A42 E219 A220 R242 K243 S244 R247 I248 T250 R331 R332 R336
BS03	CA	B	D1007 F1008 D1105	D7 F8 D105
BS04	CA	B	D1007 E1106	D7 E106
BS05	CA	B	A1181 I1186	A181 I186
BS06	DCP	B	F1008 Y1010 F1011 Y1012 A1044 T1045 Y1048 R1051 D1105 K1159	F8 Y10 F11 Y12 A44 T45 Y48 R51 D105 K159

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2atl, PDBe:2atl, PDBj:2atl
• PDBsum: 2atl
• PubMed: 16379496
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)