Structure of PDB 2asd Chain B

Receptor sequence

>2asdB (length=341) Species: 2287 (Saccharolobus solfataricus)

GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 2asd Stepwise Translocation of Dpo4 Polymerase during Error-Free Bypass of an oxoG Lesion
• Chain: B
• Resolution: 1.95 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	S1103 E1106 K1152 G1185 G1187 I1189 T1190 R1298 T1301	S103 E106 K152 G185 G187 I189 T190 R298 T301
BS02	dna	B	V1032 S1034 F1037 S1040 G1041 A1042 G1218 A1220 R1242 K1243 S1244 G1246 R1247 I1248 T1250 L1293 R1331 R1332 R1336	V32 S34 F37 S40 G41 A42 G218 A220 R242 K243 S244 G246 R247 I248 T250 L293 R331 R332 R336
BS03	CA	B	A1181 I1186	A181 I186
BS04	CA	B	D1007 F1008 D1105	D7 F8 D105
BS05	CA	B	D1007 E1106	D7 E106
BS06	DCP	B	Y1010 F1011 Y1012 A1044 T1045 Y1048 R1051 D1105 K1159	Y10 F11 Y12 A44 T45 Y48 R51 D105 K159

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2asd, PDBe:2asd, PDBj:2asd
• PDBsum: 2asd
• PubMed: 16379496
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)