Structure of PDB 2apo Chain B |
>2apoB (length=55) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence] |
EMRMKKCPKCGLYTLKEICPKCGEKTVIPKPPKFSLEDRWGKYRRMLKRA LKNKN |
|
PDB | 2apo The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. |
Chain | B |
Resolution | 1.95 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
C409 C412 C421 C424 |
C7 C10 C19 C22 |
|
|
|
|