Structure of PDB 2aou Chain B

Receptor sequence

>2aouB (length=289) Species: 9606 (Homo sapiens)

SMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSE
IKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVA
KTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPA
TLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDD
LTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNAT
APPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA

3D structure

• PDB: 2aou Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
• Chain: B
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.8: histamine N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CQA	B	Y15 F19 Q94 Q143 Y146 V173 W179 W183	Y12 F16 Q91 Q140 Y143 V170 W176 W180	MOAD: Ki=18.6nM BindingDB: Ki=19nM
BS02	CQA	B	R6 S7 W183 G187 F190 P191 D193 Y198 T245	R3 S4 W180 G184 F187 P188 D190 Y195 T242	MOAD: Ki=18.6nM BindingDB: Ki=19nM

Gene Ontology

Molecular Function

• GO:0008168 methyltransferase activity
• GO:0008170 N-methyltransferase activity
• GO:0046539 histamine N-methyltransferase activity

Biological Process

• GO:0001692 histamine metabolic process
• GO:0001695 histamine catabolic process
• GO:0006548 L-histidine catabolic process
• GO:0007585 respiratory gaseous exchange by respiratory system
• GO:0032259 methylation

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005813 centrosome
• GO:0005829 cytosol
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:2aou, PDBe:2aou, PDBj:2aou
• PDBsum: 2aou
• PubMed: 16168438
• UniProt: P50135|HNMT_HUMAN Histamine N-methyltransferase (Gene Name=HNMT)