Structure of PDB 2ahl Chain B |
>2ahlB (length=71) Species: 79261 (Streptomyces castaneoglobisporus) [Search protein sequence] |
AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVMRNADGSWISVVSHYDP VPTPRAAARAAVDELQGAPLL |
|
PDB | 2ahl Crystallographic Evidence That the Dinuclear Copper Center of Tyrosinase Is Flexible during Catalysis |
Chain | B |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
B |
H82 M84 H97 |
H32 M34 H47 |
|
|
|
|