Structure of PDB 2acz Chain B

Receptor sequence

>2aczB (length=238) Species: 562 (Escherichia coli)

MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLS
FRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVI
RDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECI
LCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDA
FSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA

3D structure

• PDB: 2acz Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
• Chain: B
• Resolution: 3.1 Å

Enzymatic activity

• Enzyme Commision number: 1.3.5.1: succinate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	B	R53 S54 C55 R56 G58 V59 C60 D63 C75	R53 S54 C55 R56 G58 V59 C60 D63 C75
BS02	SF4	B	C149 I150 C152 A153 C155 C216 L220	C149 I150 C152 A153 C155 C216 L220
BS03	F3S	B	C159 P172 C206 S208 M210 C212 T223	C159 P172 C206 S208 M210 C212 T223
BS04	AT5	B	P160 W164 H207 I209	P160 W164 H207 I209

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008177 succinate dehydrogenase (quinone) activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0009060 aerobic respiration
• GO:0019646 aerobic electron transport chain
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:2acz, PDBe:2acz, PDBj:2acz
• PDBsum: 2acz
• PubMed: 16407191
• UniProt: P07014|SDHB_ECOLI Succinate dehydrogenase iron-sulfur subunit (Gene Name=sdhB)