Structure of PDB 2aa1 Chain B

Receptor sequence
>2aa1B (length=146) Species: 35730 (Trematomus newnesi) [Search protein sequence]
VEWTDFERATIKDIFSKLEYDVVGPATLARCLVVYPWTQRYFGKFGNLYN
AAAIAQNAMVSKHGTTILNGLDRAVKNMDDITNTYAELSVLHSEKLHVDP
DNFKLLADCLTIVVAARFGSAFTGEVQAAFQKFMAVVVSSLGKQYR
3D structure
PDB2aa1 Minimal structural requirements for root effect: crystal structure of the cathodic hemoglobin isolated from the antarctic fish Trematomus newnesi
ChainB
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM B Y41 F42 H63 I67 H92 L96 V98 N102 F103 L106 L141 Y41 F42 H63 I67 H92 L96 V98 N102 F103 L106 L141
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2aa1, PDBe:2aa1, PDBj:2aa1
PDBsum2aa1
PubMed16299734
UniProtP45721|HBBC_TRENE Hemoglobin subunit beta-C

[Back to BioLiP]