Structure of PDB 2a4w Chain B |
>2a4wB (length=130) Species: 53502 (Streptomyces caespitosus) [Search protein sequence] |
SARISLFAVVVEDMAKSLEFYRKLGVEIPAEADSAPHTEAVLDGGIRLAW DTVETVRSYDPEWQAPTGGHRFAIAFEFPDTASVDKKYAELVDAGYEGHL KPWNAVWGQRYAIVKDPDGNVVDLFAPLPL |
|
PDB | 2a4w The Mitomycin C (MMC)-binding Protein from MMC-producing Microorganisms Protects from the Lethal Effect of Bleomycin: Crystallographic Analysis to Elucidate the Binding Mode of the Antibiotic to the Protein |
Chain | B |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
BLM |
B |
H238 D252 Y260 |
H37 D51 Y59 |
PDBbind-CN: -logKd/Ki=8.29,Kd=5.1nM |
|
|