Structure of PDB 1zs6 Chain B

Receptor sequence
>1zs6B (length=152) Species: 9606 (Homo sapiens) [Search protein sequence]
TGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLRE
HYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAP
PGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWL
YE
3D structure
PDB1zs6 Structure of human nucleoside-diphosphate kinase 3
ChainB
Resolution2.3 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K29 Y69 N132 H135 E146
Catalytic site (residue number reindexed from 1) K12 Y52 N115 H118 E129
Enzyme Commision number 2.7.4.6: nucleoside-diphosphate kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP B K29 L72 F77 L81 R105 T111 V129 N132 K12 L55 F60 L64 R88 T94 V112 N115
Gene Ontology
Molecular Function
GO:0004550 nucleoside diphosphate kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0046872 metal ion binding
Biological Process
GO:0006183 GTP biosynthetic process
GO:0006228 UTP biosynthetic process
GO:0006241 CTP biosynthetic process
GO:0006281 DNA repair
GO:0006915 apoptotic process
GO:0008053 mitochondrial fusion
GO:0009117 nucleotide metabolic process
GO:0009142 nucleoside triphosphate biosynthetic process
GO:0016310 phosphorylation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005741 mitochondrial outer membrane
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0036064 ciliary basal body
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zs6, PDBe:1zs6, PDBj:1zs6
PDBsum1zs6
PubMed
UniProtQ13232|NDK3_HUMAN Nucleoside diphosphate kinase 3 (Gene Name=NME3)

[Back to BioLiP]