Structure of PDB 1zh2 Chain B |
>1zh2B (length=120) Species: 562 (Escherichia coli) [Search protein sequence] |
MTNVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLII LDLGLPDGDGIEFIRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLS KPFGIGELQARLRVALRRHS |
|
PDB | 1zh2 A common dimerization interface in bacterial response regulators KdpE and TorR. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
E8 D9 D52 G54 |
E8 D9 D52 G54 |
|
|
|
|