Structure of PDB 1zeh Chain B

Receptor sequence

>1zehB (length=30) Species: 9606 (Homo sapiens)

FVNQHLCGSHLVEALYLVCGERGFFYTDKT

3D structure

• PDB: 1zeh Interactions of phenol and m-cresol in the insulin hexamer, and their effect on the association properties of B28 pro --> Asp insulin analogues.
• Chain: B
• Resolution: 1.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	C7 L11 L15 C19 R22 G23 F24 F25	C7 L11 L15 C19 R22 G23 F24 F25
BS02	CRS	B	C7 L11	C7 L11
BS03	CRS	B	Y26 T27 D28	Y26 T27 D28

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1zeh, PDBe:1zeh, PDBj:1zeh
• PDBsum: 1zeh
• PubMed: 9708987
• UniProt: P01308|INS_HUMAN Insulin (Gene Name=INS)