Structure of PDB 1ze2 Chain B

Receptor sequence

>1ze2B (length=218) Species: 2336 (Thermotoga maritima)

MKHGILVAYKPKGPTSHDVVDEVRKKLKTRKVGHGGTLDPFACGVLIIGV
NQGTRILEFYKDLKKVYGEYDQVPPAYSAKKYKGERLYKLAREGKIINLP
PKRVKIFKIRVEVSPGTYIRVRESVGPHTIEESLNVFEAAPEEIENRIIP
LEKCLEWLPRVVVHQESTKMILNGSQIHLEMLKEWDGFKKGEVVRVFNEE
GRLLALAEAERNRKVFQT

3D structure

• PDB: 1ze2 Conformational change of pseudouridine 55 synthase upon its association with RNA substrate
• Chain: B
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 5.4.99.25: tRNA pseudouridine(55) synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	R55 N244 G245 R303 K304 V305	R55 N173 G174 R213 K214 V215
BS02	rna	B	T15 H17 R24 V32 G33 H34 G36 T37 D39 F41 T54 L57 E58 K61 Y67 Y117 S118 A119 K120 K121 R126 Y128 R132 P167 G168 Y170 I171 R172	T15 H17 R24 V32 G33 H34 G36 T37 D39 F41 T54 L57 E58 K61 Y67 Y77 S78 A79 K80 K81 R86 Y88 R92 P115 G116 Y118 I119 R120

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0009982 pseudouridine synthase activity
• GO:0016853 isomerase activity
• GO:0140098 catalytic activity, acting on RNA
• GO:0160148 tRNA pseudouridine(55) synthase activity

Biological Process

• GO:0001522 pseudouridine synthesis
• GO:0006396 RNA processing
• GO:0006400 tRNA modification
• GO:0008033 tRNA processing
• GO:0009451 RNA modification
• GO:0031119 tRNA pseudouridine synthesis
• GO:1990481 mRNA pseudouridine synthesis

External links

• PDB: RCSB:1ze2, PDBe:1ze2, PDBj:1ze2
• PDBsum: 1ze2
• PubMed: 14990747
• UniProt: Q9WZW0|TRUB_THEMA tRNA pseudouridine synthase B (Gene Name=truB)