Structure of PDB 1zak Chain B

Receptor sequence

>1zakB (length=220) Species: 4577 (Zea mays)

ADPLKVMISGAPASGKGTQCELIKTKYQLAHISAGDLLRAEIAAGSENGK
RAKEFMEKGQLVPDEIVVNMVKERLRQPDAQENGWLLDGYPRSYSQAMAL
ETLEIRPDTFILLDVPDELLVERVVGRRLDPVTGKIYHLKYSPPENEEIA
SRLTQRFDDTEEKVKLRLETYYQNIESLLSTYENIIVKVQGDATVDAVFA
KIDELLGSILEKKNEMVSST

3D structure

• PDB: 1zak Structure, catalysis and supramolecular assembly of adenylate kinase from maize.
• Chain: B
• Resolution: 3.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K18 R94 R129 R158 R169
• Catalytic site (residue number reindexed from 1): K16 R92 R127 R156 R167
• Enzyme Commision number: 2.7.4.3: adenylate kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	AP5	B	P14 A15 S16 G17 K18 G19 T20 L40 R41 M58 Q62 V64 G91 R94 Q98 R125 R129 I138 H140 Y143 R158 A195 V197	P12 A13 S14 G15 K16 G17 T18 L38 R39 M56 Q60 V62 G89 R92 Q96 R123 R127 I136 H138 Y141 R156 A193 V195

Gene Ontology

Molecular Function

• GO:0004017 adenylate kinase activity
• GO:0004127 (d)CMP kinase activity
• GO:0004550 nucleoside diphosphate kinase activity
• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0016776 phosphotransferase activity, phosphate group as acceptor
• GO:0019205 nucleobase-containing compound kinase activity

Biological Process

• GO:0006139 nucleobase-containing compound metabolic process
• GO:0016310 phosphorylation
• GO:0046940 nucleoside monophosphate phosphorylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0009507 chloroplast

External links

• PDB: RCSB:1zak, PDBe:1zak, PDBj:1zak
• PDBsum: 1zak
• PubMed: 9428681
• UniProt: P43188|KADC_MAIZE Adenylate kinase, chloroplastic (Gene Name=ADK1)