Structure of PDB 1z56 Chain B |
>1z56B (length=76) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
FEMADKLYKDICCVNDSYRNIKESDSSNRNRVEQLARERELLDKLLETRD ERTRAMMVTLLNEKKKKIRELHEILR |
|
PDB | 1z56 Structure of an Xrcc4-DNA ligase IV yeast ortholog complex reveals a novel BRCT interaction mode. |
Chain | B |
Resolution | 3.92 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
M158 K161 |
M3 K6 |
|
|
|