Structure of PDB 1ytg Chain B |
>1ytgB (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGI GGFIKVRQYDQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
|
PDB | 1ytg Three-dimensional structures of HIV-1 and SIV protease product complexes. |
Chain | B |
Resolution | 2.3 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
D29 G48 I50 |
D29 G48 I50 |
|
|
|
|