Structure of PDB 1yq3 Chain B

Receptor sequence

>1yq3B (length=242) Species: 9031 (Gallus gallus)

AATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNEL
DSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHM
YVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGL
YECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQ
LQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKE

3D structure

• PDB: 1yq3 3-Nitropropionic Acid Is a Suicide Inhibitor of Mitochondrial Respiration That, upon Oxidation by Complex II, Forms a Covalent Adduct with a Catalytic Base Arginine in the Active Site of the Enzyme
• Chain: B
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 1.3.5.1: succinate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	B	C65 R66 G68 C70 G71 S72 C73 C85	C60 R61 G63 C65 G66 S67 C68 C80
BS02	SF4	B	C158 I159 L160 C161 A162 C164 A182 C225 P226	C153 I154 L155 C156 A157 C159 A177 C220 P221
BS03	F3S	B	C168 Y178 P181 C215 T217 I218 M219 N220 C221	C163 Y173 P176 C210 T212 I213 M214 N215 C216
BS04	UQ	B	P169 W173 I218	P164 W168 I213

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0006099 tricarboxylic acid cycle

External links

• PDB: RCSB:1yq3, PDBe:1yq3, PDBj:1yq3
• PDBsum: 1yq3
• PubMed: 16371358
• UniProt: Q9YHT2|SDHB_CHICK Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (Gene Name=SDHB)