Structure of PDB 1yo7 Chain B |
>1yo7B (length=120) Species: 562 (Escherichia coli) [Search protein sequence] |
MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYR SCLASFKKNGQIDEQADICESLHDHADELYRSCLARFGGSKQEKTALNMA RFIRSQTLTLLEKLNELAKG |
|
PDB | 1yo7 Structure of the ColE1 rop protein at 1.7 A resolution |
Chain | B |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H42 D46 |
H42 D46 |
|
|
|
|