Structure of PDB 1ynw Chain B

Receptor sequence
>1ynwB (length=73) Species: 9606 (Homo sapiens) [Search protein sequence]
ICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQ
RNRCQYCRYQKCLAMGMKREAVQ
3D structure
PDB1ynw Structural analysis of RXR-VDR interactions on DR3 DNA
ChainB
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B K245 H246 Y247 K260 R264 Q306 K12 H13 Y14 K27 R31 Q73
BS02 dna B E253 G254 R261 R284 Q288 R291 E20 G21 R28 R51 Q55 R58
BS03 ZN B C235 C238 C252 C255 C2 C5 C19 C22
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ynw, PDBe:1ynw, PDBj:1ynw
PDBsum1ynw
PubMed15225774
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]