Structure of PDB 1ylb Chain B |
>1ylbB (length=99) Species: 3562 (Spinacia oleracea) [Search protein sequence] |
VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGV DAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN |
|
PDB | 1ylb Structure of the Intermolecular Complex between Plastocyanin and Cytochrome f from Spinach. |
Chain | B |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
B |
H37 C84 H87 |
H37 C84 H87 |
|
|
|
|