Structure of PDB 1ybv Chain B

Receptor sequence

>1ybvB (length=270) Species: 148305 (Pyricularia grisea)

DAIPGPLGPQSASLEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANS
TESAEEVVAAIKKNGSDAACVKANVGVVEDIVRMFEEAVKIFGKLDIVCS
NSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMG
SITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKT
DMYHAVCREYIPNGENLSNEEVDEYAAVQWSPLRRVGLPIDIARVVCFLA
SNDGGWVTGKVIGIDGGACM

3D structure

• PDB: 1ybv Crystal structure of the ternary complex of 1,3,8-trihydroxynaphthalene reductase from Magnaporthe grisea with NADPH and an active-site inhibitor.
• Chain: B
• Resolution: 2.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G40 S164 H175 Y178 K182 Y223
• Catalytic site (residue number reindexed from 1): G27 S151 H162 Y165 K169 Y210
• Enzyme Commision number: 1.1.1.252: tetrahydroxynaphthalene reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	B	G36 R39 G40 I41 A61 N62 S63 N87 V88 N114 S115 G116 M162 S164 K182 P208 G210 I211 T213 M215	G23 R26 G27 I28 A48 N49 S50 N74 V75 N101 S102 G103 M149 S151 K169 P195 G197 I198 T200 M202
BS02	BEA	B	S164 Y178 G210 M215 Y216 Y223 W243	S151 Y165 G197 M202 Y203 Y210 W230

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0047039 tetrahydroxynaphthalene reductase activity

Biological Process

• GO:0042438 melanin biosynthetic process

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:1ybv, PDBe:1ybv, PDBj:1ybv
• PDBsum: 1ybv
• PubMed: 8939741
• UniProt: Q12634|T4HR_PYRO7 Tetrahydroxynaphthalene reductase (Gene Name=MGG_02252)