Structure of PDB 1y2v Chain B |
>1y2vB (length=142) Species: 5341 (Agaricus bisporus) [Search protein sequence] |
TYTISIRVYQTTPKGFFRPVERTNWKYANGGTWDEVRGEYVLTMGGSGTS GSLRFVSSDTDESFVATFGVHNYKRWCDIVTNLTNEQTALVINQEYYGVP IRDQARENQLTSYNVANAKGRRFAIEYTVTEGDNLKANLIIG |
|
PDB | 1y2v The Antineoplastic Lectin of the Common Edible Mushroom (Agaricus bisporus) Has Two Binding Sites, Each Specific for a Different Configuration at a Single Epimeric Hydroxyl |
Chain | B |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
GAL |
B |
Y28 A29 S48 |
Y27 A28 S47 |
|
|
|
|