Structure of PDB 1y17 Chain B |
>1y17B (length=123) Species: 36307 (Deinagkistrodon acutus) [Search protein sequence] |
DCPSDWSSYEGHCYKPFNEPKNWADAENFCTQQHTGSHLVSFQSTEEADF VVKLAFQTFDYGIFWMGLSKIWNQCNWQWSNAAMLKYTDWAEESYCVYFK STNNKWRSITCRMIANFVCEFQA |
|
PDB | 1y17 Characterizations and Crystal structures of two snake venom proteins with the activity of binding coagulation factor X from Agkistrodon acutus |
Chain | B |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
S41 E47 E120 |
S41 E47 E120 |
|
|
|
|