Structure of PDB 1xtu Chain B

Receptor sequence
>1xtuB (length=215) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence]
PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEI
VEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVI
GASRVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLK
VLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKG
YILPGLGDAGDRAFG
3D structure
PDB1xtu Allosteric Regulation and Communication between Subunits in Uracil Phosphoribosyltransferase from Sulfolobus solfataricus(,)
ChainB
Resolution2.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) R105 D116 D209 D212
Catalytic site (residue number reindexed from 1) R104 D115 D208 D211
Enzyme Commision number 2.4.2.9: uracil phosphoribosyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 U5P B R105 D140 M142 A144 T145 A146 S147 T148 Y202 I203 D209 A210 R104 D139 M141 A143 T144 A145 S146 T147 Y201 I202 D208 A209
BS02 CTP B R37 K91 R36 K90
BS03 CTP B R29 K30 R28 K29
BS04 CTP B E87 L90 K91 P94 A96 E86 L89 K90 P93 A95
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004422 hypoxanthine phosphoribosyltransferase activity
GO:0004845 uracil phosphoribosyltransferase activity
GO:0005525 GTP binding
GO:0016757 glycosyltransferase activity
Biological Process
GO:0006178 guanine salvage
GO:0006223 uracil salvage
GO:0008655 pyrimidine-containing compound salvage
GO:0032263 GMP salvage
GO:0032264 IMP salvage
GO:0044206 UMP salvage
GO:0046100 hypoxanthine metabolic process
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1xtu, PDBe:1xtu, PDBj:1xtu
PDBsum1xtu
PubMed15654744
UniProtQ980Q4|UPP_SACS2 Uracil phosphoribosyltransferase (Gene Name=upp)

[Back to BioLiP]