Structure of PDB 1xtt Chain B

Receptor sequence

>1xttB (length=208) Species: 2287 (Saccharolobus solfataricus)

PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEI
VEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVI
GASRVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVK
ANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLG
DAGDRAFG

3D structure

• PDB: 1xtt Allosteric Regulation and Communication between Subunits in Uracil Phosphoribosyltransferase from Sulfolobus solfataricus(,)
• Chain: B
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R105 D116 D209 D212
• Catalytic site (residue number reindexed from 1): R104 D108 D201 D204
• Enzyme Commision number: 2.4.2.9: uracil phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	U5P	B	R80 D140 M142 A144 T145 A146 T148 Y202 I203 G208 D209 A210	R79 D132 M134 A136 T137 A138 T140 Y194 I195 G200 D201 A202

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004422 hypoxanthine phosphoribosyltransferase activity
• GO:0004845 uracil phosphoribosyltransferase activity
• GO:0005525 GTP binding
• GO:0016757 glycosyltransferase activity

Biological Process

• GO:0006178 guanine salvage
• GO:0006223 uracil salvage
• GO:0008655 pyrimidine-containing compound salvage
• GO:0032263 GMP salvage
• GO:0032264 IMP salvage
• GO:0044206 UMP salvage
• GO:0046100 hypoxanthine metabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:1xtt, PDBe:1xtt, PDBj:1xtt
• PDBsum: 1xtt
• PubMed: 15654744
• UniProt: Q980Q4|UPP_SACS2 Uracil phosphoribosyltransferase (Gene Name=upp)