Structure of PDB 1xso Chain B

Receptor sequence
>1xsoB (length=150) Species: 8355 (Xenopus laevis) [Search protein sequence]
VKAVCVLAGSGDVKGVVHFEQQDEGAVSVEGKIEGLTDGLHGFHIHVFGD
NTNGCMSAGSHFNPENKNHGAPGDTDRHVGDLGNVTAEGGVAQFKITDSL
ISLKGPNSIIGRTAVVHEKADDLGKGGNDESLKTGNAGGRLACGVIGYSP
3D structure
PDB1xso Three-dimensional structure of Xenopus laevis Cu,Zn superoxide dismutase b determined by X-ray crystallography at 1.5 A resolution.
ChainB
Resolution1.49 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H44 H46 H61 H69 H78 D81 H118 R141
Catalytic site (residue number reindexed from 1) H44 H46 H61 H69 H78 D81 H117 R140
Enzyme Commision number 1.15.1.1: superoxide dismutase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CU B H44 H46 H61 H118 H44 H46 H61 H117
BS02 ZN B H61 H69 H78 D81 H61 H69 H78 D81
Gene Ontology
Molecular Function
GO:0004784 superoxide dismutase activity
GO:0005507 copper ion binding
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
Biological Process
GO:0006801 superoxide metabolic process
GO:0019430 removal of superoxide radicals
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005777 peroxisome
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1xso, PDBe:1xso, PDBj:1xso
PDBsum1xso
PubMed15299740
UniProtP15107|SOD1B_XENLA Superoxide dismutase [Cu-Zn] B (Gene Name=sod1-b)

[Back to BioLiP]