Structure of PDB 1xo0 Chain B

Receptor sequence

>1xo0B (length=322) Species: 10678 (Punavirus P1)

SDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPE
DVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRR
IRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAYN
TLLKIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTK
LVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATH
RLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVN
IVMNYIRNLDSETGAMVRLLED

3D structure

• PDB: 1xo0 Peptide trapping of the Holliday junction intermediate in Cre-loxP site-specific recombination.
• Chain: B
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	K43 M44 S47 R50 R81 L83 A84 K86 T87 K132 Q156 R159 K201 T202 R241 V242 K244 S257 R259 R282 R292 W315 T316 Y324 R326	K24 M25 S28 R31 R62 L64 A65 K67 T68 K113 Q137 R140 K182 T183 R222 V223 K225 S238 R240 R263 R273 W296 T297 Y305 R307
BS02	dna	B	F37 S38 H40 T41 M97 R100 R101 A175 K201 R243 R259 E262 R282 Y283 S287 G288 H289	F18 S19 H21 T22 M78 R81 R82 A156 K182 R224 R240 E243 R263 Y264 S268 G269 H270

Gene Ontology

Molecular Function

• GO:0003677 DNA binding

Biological Process

• GO:0006310 DNA recombination
• GO:0015074 DNA integration

External links

• PDB: RCSB:1xo0, PDBe:1xo0, PDBj:1xo0
• PDBsum: 1xo0
• PubMed: 15591069
• UniProt: P06956|RECR_BPP1 Recombinase cre (Gene Name=cre)