Structure of PDB 1xhv Chain B

Receptor sequence

>1xhvB (length=252) Species: 727 (Haemophilus influenzae)

SFIKPIYQDINSILIGQKVKRPKSGHAAGEPFEKLVYKFLKENLSDLTFK
QYEYLNDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLF
EEKQNDTADILLVKDQFYELLDVKTRNISKSAQAPNIISAYKLAQTCAKM
IDNKEFDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAA
MQIQFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKK
YI

3D structure

• PDB: 1xhv Mechanistic Insights from the Structures of HincII Bound to Cognate DNA Cleaved from Addition of Mg(2+) and Mn(2+)
• Chain: B
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	Q109 N110 S144 K147 A205 Q207	Q104 N105 S139 K142 A200 Q202
BS02	dna	B	G30 H31 E38 D114 T130 N132 K135 S136 A137 Q138 A139 P140 N141	G25 H26 E33 D109 T125 N127 K130 S131 A132 Q133 A134 P135 N136
BS03	dna	B	Q138 Y199 N201 A204 R241	Q133 Y194 N196 A199 R236
BS04	dna	B	H73 E74 Y77 K93 Q109	H68 E69 Y72 K88 Q104
BS05	MN	B	E38 D114 V128	E33 D109 V123
BS06	MN	B	H73 E74	H68 E69

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:1xhv, PDBe:1xhv, PDBj:1xhv
• PDBsum: 1xhv
• PubMed: 15476804
• UniProt: P17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)