Structure of PDB 1xhu Chain B

Receptor sequence

>1xhuB (length=256) Species: 727 (Haemophilus influenzae)

SFIKPIYQDINSILIGQKVKRPKSGTLSGHAAGEPFEKLVYKFLKENLSD
LTFKQYEYLNDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSI
ENLFEEKQNDTADILLVKDQFYELLDVKTRNISKSAQAPNIISAYKLAQT
CAKMIDNKEFDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYIN
WAAAMQIQFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVK
PFKKYI

3D structure

• PDB: 1xhu Mechanistic Insights from the Structures of HincII Bound to Cognate DNA Cleaved from Addition of Mg(2+) and Mn(2+)
• Chain: B
• Resolution: 2.95 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	Q109 N110 S144 K147 A205 Q207	Q108 N109 S143 K146 A204 Q206
BS02	dna	B	G30 H31 E35 D114 T130 R131 N132 K135 S136 A137 Q138 A139 P140 N141	G29 H30 E34 D113 T129 R130 N131 K134 S135 A136 Q137 A138 P139 N140
BS03	dna	B	Q138 Y199 N201 A203 A204 R241 K248	Q137 Y198 N200 A202 A203 R240 K247
BS04	dna	B	H31 Y77 R91 G92 K93 K108 Q109	H30 Y76 R90 G91 K92 K107 Q108

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:1xhu, PDBe:1xhu, PDBj:1xhu
• PDBsum: 1xhu
• PubMed: 15476804
• UniProt: P17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)