Structure of PDB 1wpu Chain B

Receptor sequence
>1wpuB (length=147) Species: 1423 (Bacillus subtilis) [Search protein sequence]
TLHKERRIGRLSVLLLLNEAEESTQVEELERDGWKVCLGKVGSMDAHKVI
AAIETASKKSGVIQSEGYRESHALYHATMEALHGVTRGEMLLGSLLRTVG
LRFAVLRGNPYESEAEGDWIAVSLYGTIGAPIKGLEHETFGVGINHI
3D structure
PDB1wpu Crystal Structure of Activated HutP; An RNA Binding Protein that Regulates Transcription of the hut Operon in Bacillus subtilis
ChainB
Resolution1.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B K41 V42 G43 S44 A53 T56 A57 K60 T99 V100 G101 L102 T128 A131 P132 I133 K134 E137 K40 V41 G42 S43 A52 T55 A56 K59 T98 V99 G100 L101 T127 A130 P131 I132 K133 E136
BS02 HIS B R88 R98 G130 A131 H138 R87 R97 G129 A130 H137
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
Biological Process
GO:0006547 L-histidine metabolic process
GO:0010628 positive regulation of gene expression

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1wpu, PDBe:1wpu, PDBj:1wpu
PDBsum1wpu
PubMed
UniProtP10943|HUTP_BACSU Hut operon positive regulatory protein (Gene Name=hutP)

[Back to BioLiP]