Structure of PDB 1wja Chain B |
>1wjaB (length=47) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKG |
|
PDB | 1wja Solution structure of the N-terminal zinc binding domain of HIV-1 integrase. |
Chain | B |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H12 H16 C40 |
H12 H16 C40 |
|
|
|
|