Structure of PDB 1w8f Chain B
Receptor sequence
| >1w8fB (length=114) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
| ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVI GTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDN DYNDAVVVINWPLG |
3D structure
| PDB | 1w8f Structural Basis for the Interaction between Human Milk Oligosaccharides and the Bacterial Lectin Pa-Iil of Pseudomonas Aeruginosa. | ||
| Chain | B | ||
| Resolution | 1.05 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | FUC | B | N21 S22 S23 D96 D99 D101 D104 | N21 S22 S23 D96 D99 D101 D104 | |
| BS02 | CA | B | E95 D99 D101 D104 | E95 D99 D101 D104 | |
| BS03 | CA | B | N21 D101 N103 D104 | N21 D101 N103 D104 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0030246 | carbohydrate binding |
| GO:0046872 | metal ion binding |
