Structure of PDB 1w6u Chain B

Receptor sequence
>1w6uB (length=286) Species: 9606 (Homo sapiens) [Search protein sequence]
MNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLG
AQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIK
VAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQL
IKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGM
RFNVIQPGPIKTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWIN
GAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELI
3D structure
PDB1w6u Structure and Reactivity of Human Mitochondrial 2,4-Dienoyl-Coa Reductase: Enzyme-Ligand Interactions in a Distinctive Short-Chain Reductase Active Site
ChainB
Resolution1.75 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G70 T196 A200 V207 P209 K214
Catalytic site (residue number reindexed from 1) G37 T163 A167 V174 P176 K181
Enzyme Commision number 1.3.1.124: 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing].
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAP B G66 T69 G70 L71 S90 R91 K92 C116 D117 V118 N144 A145 A146 I167 I195 T196 K214 P242 I243 G33 T36 G37 L38 S57 R58 K59 C83 D84 V85 N111 A112 A113 I134 I162 T163 K181 P209 I210
BS02 HXC B G147 N148 F149 I150 S157 N159 A160 G114 N115 F116 I117 S124 N126 A127
Gene Ontology
Molecular Function
GO:0008670 2,4-dienoyl-CoA reductase (NADPH) activity
GO:0016491 oxidoreductase activity
GO:0042802 identical protein binding
GO:0070402 NADPH binding
Biological Process
GO:0006631 fatty acid metabolic process
GO:0006635 fatty acid beta-oxidation
GO:0120162 positive regulation of cold-induced thermogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005829 cytosol
GO:1902494 catalytic complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1w6u, PDBe:1w6u, PDBj:1w6u
PDBsum1w6u
PubMed15531764
UniProtQ16698|DECR_HUMAN 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial (Gene Name=DECR1)

[Back to BioLiP]