Structure of PDB 1vzm Chain B

Receptor sequence
>1vzmB (length=42) Species: 172269 (Argyrosomus regius) [Search protein sequence]
ELTLAQTESLREVCETNMACDEMADAQGIVAAYQAFYGPIPF
3D structure
PDB1vzm Structural Evidence of a Fourth Gla Residue in Fish Osteocalcin: Biological Implications
ChainB
Resolution1.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG B E11 E15 E8 E12
BS02 MG B E18 D24 E15 D21
BS03 MG B E18 D24 E15 D21
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
Biological Process
GO:0030500 regulation of bone mineralization
GO:0032571 response to vitamin K
GO:0060348 bone development
GO:1900076 regulation of cellular response to insulin stimulus
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1vzm, PDBe:1vzm, PDBj:1vzm
PDBsum1vzm
PubMed15667217
UniProtQ800Y1|OSTCN_ARGRE Osteocalcin (Gene Name=bglap)

[Back to BioLiP]