Structure of PDB 1vto Chain B

Receptor sequence

>1vtoB (length=188) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

PVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAV
IMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKF
KDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKI
VLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI

3D structure

PDB

1vto 1.9 A Resolution Refined Structure of TBP Recognizing the Minor Groove of TATAAAAG

Chain

Resolution

1.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	V1029 F1057 F1074 S1076 V1080 Q1116 N1117 L1147 F1148 R1154 L1163 T1173	V19 F47 F64 S66 V70 Q106 N107 L137 F138 R144 L153 T163
BS02	dna	B	Q1026 N1027 R1056 F1057 I1061 R1063 T1070 T1082 V1119 P1149 F1165 S1167 K1169 V1171	Q16 N17 R46 F47 I51 R53 T60 T72 V109 P139 F155 S157 K159 V161

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding

	Biological Process
GO:0006352	DNA-templated transcription initiation

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1vto, PDBe:1vto, PDBj:1vto
PDBsum	1vto
PubMed	7634103
UniProt	P28147\|TBP1_ARATH TATA-box-binding protein 1 (Gene Name=TBP1)

[Back to BioLiP]