Structure of PDB 1vj2 Chain B |
>1vj2B (length=114) Species: 2336 (Thermotoga maritima) [Search protein sequence] |
MILKRAYDVTPQKISTDKVRGVRKRVLIGLKDAPNFVMRLFTVEPGGLID RHSHPWEHEIFVLKGKLTVLKEQGEETVEEGFYIFVEPNEIHGFRNDTDS EVEFLCLIPKEGGE |
|
PDB | 1vj2 Crystal structure of a novel manganese-containing cupin (TM1459) from Thermotoga maritima at 1.65 A resolution. |
Chain | B |
Resolution | 1.65 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
B |
H52 H54 H58 H92 |
H52 H54 H58 H92 |
|
|
|
|