Structure of PDB 1v3t Chain B

Receptor sequence

>1v3tB (length=330) Species: 10141 (Cavia porcellus)

FMVKAKSWTLKKHFQGKPTQSDFELKTVELPPLKNGEVLLEALFLSVDPY
MRIASKRLKEGAVMMGQQVARVVESKNSAFPAGSIVLAQSGWTTHFISDG
KGLEKLLTEWPDKLPLSLALGTIGMPGLTAYFGLLEVCGVKGGETVLVSA
AAGAVGSVVGQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSL
EEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNRMD
QLPPGPSPESIIYKQLRIEGFIVYRWQGDVREKALRDLMKWVLEGKIQYH
EHVTKGFENMPAAFIEMLNGANLGKAVVTA

3D structure

• PDB: 1v3t Structural basis of leukotriene B4 12-hydroxydehydrogenase/15-Oxo-prostaglandin 13-reductase catalytic mechanism and a possible Src homology 3 domain binding loop
• Chain: B
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 1.3.1.48: 15-oxoprostaglandin 13-reductase.
  1.3.1.74: 2-alkenal reductase [NAD(P)(+)].

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	B	P48 M124 T128 G152 A153 V154 A173 G174 K178 Y193 N217 V218 C239 I242 Y245 F270 I271 V272 M316 L317 G319 N321	P49 M125 T129 G153 A154 V155 A174 G175 K179 Y194 N218 V219 C240 I243 Y246 F271 I272 V273 M317 L318 G320 N322

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
• GO:0032440 2-alkenal reductase [NAD(P)+] activity
• GO:0035798 2-alkenal reductase (NADPH) activity
• GO:0036185 13-lipoxin reductase activity
• GO:0047522 15-oxoprostaglandin 13-oxidase [NAD(P)+] activity
• GO:0097257 leukotriene B4 12-hydroxy dehydrogenase activity

Biological Process

• GO:0006693 prostaglandin metabolic process
• GO:0036102 leukotriene B4 metabolic process
• GO:2001302 lipoxin A4 metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1v3t, PDBe:1v3t, PDBj:1v3t
• PDBsum: 1v3t
• PubMed: 15007077
• UniProt: Q9EQZ5|PTGR1_CAVPO Prostaglandin reductase 1 (Gene Name=Ptgr1)