Structure of PDB 1uum Chain B

Receptor sequence

>1uumB (length=350) Species: 10117 (Rattus rattus) [Search protein sequence]

YAEYLMPGLQRLLDPESAHRLAVRVTSLGLLPRATFQDSDMLEVKVLGHK
FRNPVGIAAGFDKNGEAVDGLYKLGFGFVEVGSVTPQPQEGNPRPRVFRL
PEDQAVINRYGFNSHGLSVVEHRLRARQQKQAQLTADGLPLGINLGKNKT
SEDAAADYAEGVRTLGPLADYLVVNVSSQGKTELRHLLSKVLQERDALKG
TRKPAVLVKIAPDLTAQDKEDIASVARELGIDGLIVTNTTVSRPVGLQGA
LRSETGGLSGKPLRDLSTQTIREMYALTQGRIPIIGVGGVSSGQDALEKI
QAGASLVQLYTALIFLGPPVVVRVKRELEALLKERGFTTVTDAIGADHRR

3D structure

PDB

1uum Inhibitor Binding in a Class 2 Dihydroorotate Dehydrogenase Causes Variations in the Membrane-Associated N-Terminal Domain

Chain

Resolution

2.3 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	G119 N145 F149 S215 K255 N284
Catalytic site (residue number reindexed from 1)	G82 N108 F112 S178 K209 N238
Enzyme Commision number	1.3.5.2: dihydroorotate dehydrogenase (quinone).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	B	A95 A96 G97 K100 S120 N145 Y147 N181 N212 K255 N284 T285 S305 G306 V333 G334 G335 L355 Y356 T357	A58 A59 G60 K63 S83 N108 Y110 N144 N175 K209 N238 T239 S259 G260 V287 G288 G289 L309 Y310 T311
BS02	AFI	B	E40 M43 P44 Q47 P52 A55 H56 V134 R136 Y356 I360 P364	E3 M6 P7 Q10 P15 A18 H19 V97 R99 Y310 I314 P318	MOAD: ic50=698nM

Gene Ontology

	Molecular Function
GO:0004151	dihydroorotase activity
GO:0004152	dihydroorotate dehydrogenase activity
GO:0010181	FMN binding
GO:0016491	oxidoreductase activity
GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors
GO:0048038	quinone binding
GO:0048039	ubiquinone binding
GO:0106430	dihydroorotate dehydrogenase (quinone) activity

	Biological Process
GO:0006207	'de novo' pyrimidine nucleobase biosynthetic process
GO:0006221	pyrimidine nucleotide biosynthetic process
GO:0006225	UDP biosynthetic process
GO:0007565	female pregnancy
GO:0007595	lactation
GO:0009220	pyrimidine ribonucleotide biosynthetic process
GO:0009410	response to xenobiotic stimulus
GO:0014070	response to organic cyclic compound
GO:0031000	response to caffeine
GO:0042594	response to starvation
GO:0043065	positive regulation of apoptotic process
GO:0044205	'de novo' UMP biosynthetic process
GO:0090140	regulation of mitochondrial fission
GO:1903576	response to L-arginine

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0016020	membrane
GO:0043025	neuronal cell body

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1uum, PDBe:1uum, PDBj:1uum
PDBsum	1uum
PubMed	15044733
UniProt	Q63707\|PYRD_RAT Dihydroorotate dehydrogenase (quinone), mitochondrial (Gene Name=Dhodh)

[Back to BioLiP]