Structure of PDB 1umz Chain B

Receptor sequence

>1umzB (length=264) Species: 113636 (Populus tremula)

VAFGRNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSM
QMKLVPGDSAGTVTAFYLSSQNSEHDEIDFEFLGNRTGQPYILQTNVFTG
GKGDREQRIYLWFDPTKEFHYYSVLWNMYMIVFLVDDVPIRVFKNCKDLG
VKFPFNQPMKIYSSLWNADDWATRGGLEKTDWSKAPFIASYRSFHIDGCE
ASVEAKFCATQGARWWDQKEFQDLDAFQYRRLSWVRQKYTIYNYCTDRSR
YPSMPPECKRDRDI

3D structure

• PDB: 1umz Crystal Structures of a Poplar Xyloglucan Endotransglycosylase Reveal Details of Transglycosylation Acceptor Binding
• Chain: B
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E85 D87 E89
• Catalytic site (residue number reindexed from 1): E77 D79 E81
• Enzyme Commision number: 2.4.1.207: xyloglucan:xyloglucosyl transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BGC	B	R116 W179	R108 W171
BS02	BGC	B	E89 E114	E81 E106
BS03	XYS	B	W174 D178 W179	W166 D170 W171
BS04	XYS	B	E114 Y250	E106 Y242
BS05	GAL	B	D112 E114 R258	D104 E106 R250

Gene Ontology

Molecular Function

• GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds
• GO:0016757 glycosyltransferase activity
• GO:0016762 xyloglucan:xyloglucosyl transferase activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0030247 polysaccharide binding

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0010411 xyloglucan metabolic process
• GO:0042546 cell wall biogenesis
• GO:0044042 glucan metabolic process
• GO:0071555 cell wall organization

Cellular Component

• GO:0005618 cell wall
• GO:0005737 cytoplasm
• GO:0048046 apoplast

External links

• PDB: RCSB:1umz, PDBe:1umz, PDBj:1umz
• PDBsum: 1umz
• PubMed: 15020748
• UniProt: Q8GZD5|XTH34_POPPZ Xyloglucan endotransglucosylase protein 34 (Gene Name=XTH16-34)