Structure of PDB 1uaq Chain B

Receptor sequence

>1uaqB (length=151) Species: 4932 (Saccharomyces cerevisiae)

SKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKG
SATLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCV
VGENVNFKSKGEKYLQTRGHEVVVVDDERCKKIMKQFIDERPQDWFEDIG
E

3D structure

• PDB: 1uaq Crystal structure of yeast cytosine deaminase. Insights into enzyme mechanism and evolution
• Chain: B
• Resolution: 1.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H62 E64 S89 C91 C94
• Catalytic site (residue number reindexed from 1): H55 E57 S82 C84 C87
• Enzyme Commision number: 3.5.4.1: cytosine deaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	H62 C91 C94	H55 C84 C87
BS02	DUC	B	I33 N51 H62 E64 C91 C94 D155	I26 N44 H55 E57 C84 C87 D148

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004131 cytosine deaminase activity
• GO:0008270 zinc ion binding
• GO:0008835 diaminohydroxyphosphoribosylaminopyrimidine deaminase activity
• GO:0016787 hydrolase activity
• GO:0016814 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
• GO:0019239 deaminase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0008655 pyrimidine-containing compound salvage
• GO:0019858 cytosine metabolic process
• GO:0034654 nucleobase-containing compound biosynthetic process
• GO:0044206 UMP salvage
• GO:0046087 cytidine metabolic process

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:1uaq, PDBe:1uaq, PDBj:1uaq
• PDBsum: 1uaq
• PubMed: 12637534
• UniProt: Q12178|FCY1_YEAST Cytosine deaminase (Gene Name=FCY1)