Structure of PDB 1u9z Chain B

Receptor sequence

>1u9zB (length=274) Species: 2190 (Methanocaldococcus jannaschii)

MIVVSGSQSQNLAFKVAKLLNTKLTRVEYKRFPDNEIYVRIVDEINDDEA
VIINTQKNQNDAIVETILLCDALRDEGVKKITLVAPYLAYARQDKKFNPG
EAISIRALAKIYSNIVDKLITINPHETHIKDFFTIPFIYGDAVPKLAEYV
KDKLNDPIVLAPDKGALEFAKTASKILNAEYDYLEIAPKTLDAKDRDVFI
VDDIISTGGTMATAVKLLKEQGAKKIIAACVHPVLIGDALNKLYSAGVEE
VVGTDTYLSEVSKVSVAEVIVDLL

3D structure

• PDB: 1u9z Novel class III phosphoribosyl diphosphate synthase: structure and properties of the tetrameric, phosphate-activated, non-allosterically inhibited enzyme from Methanocaldococcus jannaschii
• Chain: B
• Resolution: 2.8 Å

Enzymatic activity

• Enzyme Commision number: 2.7.6.1: ribose-phosphate diphosphokinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	R5P	B	D163 D212 I215 S216 T217 G218 T220	D163 D202 I205 S206 T207 G208 T210
BS02	AMP	B	F32 D34 E36	F32 D34 E36
BS03	AMP	B	R92 Q93 F97 H125	R92 Q93 F97 H125

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004749 ribose phosphate diphosphokinase activity
• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006015 5-phosphoribose 1-diphosphate biosynthetic process
• GO:0006164 purine nucleotide biosynthetic process
• GO:0009165 nucleotide biosynthetic process
• GO:0016310 phosphorylation

Cellular Component

• GO:0002189 ribose phosphate diphosphokinase complex
• GO:0005737 cytoplasm

External links

• PDB: RCSB:1u9z, PDBe:1u9z, PDBj:1u9z
• PDBsum: 1u9z
• PubMed: 16288921
• UniProt: Q58761|KPRS_METJA Ribose-phosphate pyrophosphokinase (Gene Name=prs)