Structure of PDB 1u9m Chain B |
>1u9mB (length=82) Species: 9913 (Bos taurus) [Search protein sequence] |
AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGG DATENWEDVGHSTDARELSKTFIIGELHPDDR |
|
PDB | 1u9m Structure of the F58W mutant of cytochrome b5: the mutation leads to multiple conformations and weakens stacking interactions. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H39 G62 |
Catalytic site (residue number reindexed from 1) |
H37 G60 |
Enzyme Commision number |
? |
|
|
|
|