Structure of PDB 1u9k Chain B |
>1u9kB (length=110) Species: 10090 (Mus musculus) [Search protein sequence] |
EEERYDLVEGQTLTVKCPFNIMKYANSQKAWQRLPDGKEPLTLVVTQRPF TRPSEVHMGKFTLKHDPSEAMLQVQMTDLQVTDSGLYRCVIYHPPNDPVV LFHPVRLVVT |
|
PDB | 1u9k Crystal Structure of Mouse Triggering Receptor Expressed on Myeloid Cells 1 (TREM-1) at 1.76A |
Chain | B |
Resolution | 1.76 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
E33 T134 |
E9 T110 |
|
|
|