Structure of PDB 1u21 Chain B

Receptor sequence

>1u21B (length=116) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTNP

3D structure

• PDB: 1u21 Kinetic stabilization of an oligomeric protein by a single ligand binding event
• Chain: B
• Resolution: 1.69 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	P2C	B	K15 L17 L110 S117	K6 L8 L101 S108	MOAD: Kd=5nM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:1u21, PDBe:1u21, PDBj:1u21
• PDBsum: 1u21
• PubMed: 15826192
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)