Structure of PDB 1u12 Chain B |
>1u12B (length=127) Species: 266835 (Mesorhizobium japonicum MAFF 303099) [Search protein sequence] |
GDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGD RMFFVVEGSVSVATPNPVELGPGAFFGEMALISGEPRSATVSAATTVSLL SLHSADFQMLCSSSPEIAEIFRKTALE |
|
PDB | 1u12 Structural Basis of Ligand Activation in a Cyclic Nucleotide Regulated Potassium Channel |
Chain | B |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
K |
B |
A283 P287 |
A63 P67 |
|
|
|
|